PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_23904_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MYB
Protein Properties Length: 283aa    MW: 32203.2 Da    PI: 9.0189
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_23904_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.33.1e-072467344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                     +WT+eE +++  a + +      +W ++a++++ g+t  +++  +
   Neem_23904_f_2 24 SWTKEENKRFESALAIYSEStpdRWIKVAAMIP-GKTVLDVIKQY 67
                     7*****************98*************.***99998776 PP

2Myb_DNA-binding42.12e-13124168347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+++++++  ++G+g+W+ I+r +   +t+ q+ s+ qky
   Neem_23904_f_2 124 PWTEEEHLQFLKGLMKYGKGDWRNISRNFVISKTPTQVASHAQKY 168
                      8*****************************789***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.822075IPR017884SANT domain
SMARTSM007175.3E-72173IPR001005SANT/Myb domain
SuperFamilySSF466893.44E-112378IPR009057Homeodomain-like
CDDcd001674.61E-62470No hitNo description
PfamPF002496.2E-62467IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-12114173IPR009057Homeodomain-like
PROSITE profilePS5129420.212117173IPR017930Myb domain
SuperFamilySSF466892.47E-15119172IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-17120172IPR006447Myb domain, plants
SMARTSM007173.0E-12121171IPR001005SANT/Myb domain
PfamPF002499.1E-12124168IPR001005SANT/Myb domain
CDDcd001675.47E-10124169No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
METLYPASYM SNSNWFLQQN QSTSWTKEEN KRFESALAIY SESTPDRWIK VAAMIPGKTV  60
LDVIKQYEEL EEDISNIEAG KIPIPGYLSS SFTLELVPER DYDANRKKPL VAKNSDHERK  120
KGVPWTEEEH LQFLKGLMKY GKGDWRNISR NFVISKTPTQ VASHAQKYFI RQLSGGKDKR  180
RPSIHDITTV NLTDKTLSDD LKPPSFDQSN MLSAQQKSLS MPKFGSEWNG SNNGASMVFN  240
STNTNLFMPS AYEFGSDGLK LQGQNLYHTA YHGAHIRPQT SLY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1625901176RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006486372.11e-168PREDICTED: transcription factor DIVARICATA-like
RefseqXP_006435669.11e-168hypothetical protein CICLE_v10032309mg
SwissprotQ8S9H78e-96DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A067G0731e-168A0A067G073_CITSI; Uncharacterized protein
STRINGPOPTR_0010s20040.11e-131(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.14e-95MYB family protein